PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 468aa    MW: 51126.1 Da    PI: 5.4134
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493565.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-165599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++v+a k++G   W+ I +++g ++t+ q++s+ qk+
   XP_016493565.1 55 REKWTEEEHQRFVEALKLYGRA-WRQIEEHVG-TKTAIQIRSHAQKF 99
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.06E-1649103IPR009057Homeodomain-like
PROSITE profilePS5129421.97150104IPR017930Myb domain
TIGRFAMsTIGR015579.9E-1753102IPR006447Myb domain, plants
SMARTSM007171.0E-1254102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-95495IPR009057Homeodomain-like
PfamPF002492.5E-135598IPR001005SANT/Myb domain
CDDcd001671.07E-957100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MVAEALNQDE GARRGGSSMI SSKLETVATQ GKALTCLANE ITLKVRKPYT ITKQREKWTE  60
EEHQRFVEAL KLYGRAWRQI EEHVGTKTAI QIRSHAQKFF AKVARDSGTD GDESLNAIDI  120
PPPRPKKKPL HPYPRKMADS PVTNKSVSGQ PERSSPPNAS GRDSCSPDSV LSEIGSDVSE  180
YLVAEQQSSR FSPYSCTTDA HAANIISGQN GDESMTSKSN IVKEIPVASK PVAASSSSIF  240
NSGMECDFVP RETSFPGEKL AVEAPLASIK LFGQMVLVPD ATKLALQSPA GSCNSLPSKT  300
TENEIETNNG NVIHGFQANS QFILPVVPGN MIPSACWLSQ DMLENNPEGV AAFPTTIPWL  360
SWYQDLVYRY ISLCSQTAAE TTTLCRRPED EEPQREGSSS GLSVGSASEV DDGNRSSETV  420
ESKYTTKSDK WNNIKGFVPY KRCLAERDGM SSGVELEERE SQRVRVCS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768903.10.0PREDICTED: uncharacterized protein LOC104219851 isoform X1
RefseqXP_016493565.10.0PREDICTED: uncharacterized protein LOC107812899 isoform X1
TrEMBLM1CEP80.0M1CEP8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000658500.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.13e-38MYB_related family protein